PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA022580-PA
Common NameOsI_22248
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Nin-like
Protein Properties Length: 534aa    MW: 61881.9 Da    PI: 6.7303
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA022580-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK88.45.9e-28411461252
            RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       ek +++e +s+yF++pi++AA+eL+v+lT+LK++CR++GI+RWPhRk+ksl
  BGIOSGA022580-PA 411 EKALTFELVSQYFYMPITQAARELNVGLTLLKKKCRELGIPRWPHRKMKSL 461
                       799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS513755.294114IPR002885Pentatricopeptide repeat
Gene3DG3DSA:1.25.40.104.1E-815251IPR011990Tetratricopeptide-like helical domain
PROSITE profilePS513759.4381549IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007563.3E-51845IPR002885Pentatricopeptide repeat
PfamPF015351.3E-41844IPR002885Pentatricopeptide repeat
PfamPF015350.00344970IPR002885Pentatricopeptide repeat
PROSITE profilePS513758.96682116IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007563.8E-585109IPR002885Pentatricopeptide repeat
PfamPF015351.3E-485109IPR002885Pentatricopeptide repeat
PROSITE profilePS5137510.567127161IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007564.6E-5129159IPR002885Pentatricopeptide repeat
PfamPF015359.6E-5129158IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007566.5E-4160185IPR002885Pentatricopeptide repeat
PfamPF015358.5E-7160186IPR002885Pentatricopeptide repeat
PROSITE profilePS513756.193162188IPR002885Pentatricopeptide repeat
PROSITE profilePS5137510.709189223IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007562.1E-4191220IPR002885Pentatricopeptide repeat
PfamPF015351.2E-5191220IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007569.4E-5222252IPR002885Pentatricopeptide repeat
PfamPF015356.2E-7222249IPR002885Pentatricopeptide repeat
PROSITE profilePS513756.555224254IPR002885Pentatricopeptide repeat
PROSITE profilePS5151918.974397481IPR003035RWP-RK domain
PfamPF020422.4E-21414461IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 534 aa     Download sequence    Send to blast
MDEARRLFDE MPQRNAASWN TMVTGFFAAG QVVKALDVFD AMPAKDSASL STMVSGFTKN  60
GMLHEAEELL TKRLSVTDMD KAVDAYNTLI VAYGQAGRFS DAKRLFDMIP KGQYQHNMLK  120
RKGFERNVVS WNSMMICYIK AGDVCSARAL FNEMPDKDLV SWNTMISGYT QASDMKESEK  180
LFWEMPDPDT VSWNLIIQGF MQKGEAEHAR GFFDRMPERG TISWNTMISG YEKNGNYISS  240
VKLFSKMLEV DWQWHNPMSL EMNQLTQVKL IAKRNNQIMD KQATATKMHK ATNIRHIYSK  300
FKVDEQQNTS WWPYCTSLWP DSYLLEEEAL FSSLSFPSFH PQPVYSTVMQ SNVLQDELGV  360
IFEDDVLKYW DEMEQSENKV EKSEKGLPLL YYGDENGAAS KIMRDDVRSE EKALTFELVS  420
QYFYMPITQA ARELNVGLTL LKKKCRELGI PRWPHRKMKS LQTLINNVQV LQEASKANNE  480
EQLRMLVEML QEERRLLEQK PYVQLEEKTK RLRQACFKAN YKKRRLLALE AGEP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5i9d_A1e-36125415434pentatricopeptide repeat protein dPPR-U8A2
5i9g_C2e-3612542434pentatricopeptide repeat protein dPPR-U8C2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0035090.0AP003509.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0525F01.
GenBankAP0035690.0AP003569.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0425F05.
GenBankAP0149620.0AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642248.10.0PREDICTED: pentatricopeptide repeat-containing protein At1g62260, mitochondrial
TrEMBLA2YAY00.0A2YAY0_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA022580-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP108991212
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.11e-35RWP-RK domain-containing protein